DPCstruct | MC33618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 270 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1AXG5 | 233-477 | PVDTSPATPLPGHPERPASPRYSVMADHQSVPVKAERYDFDVALFTLDEGPAEVEISVADGFSGYTLKPSRHNLTVNRSGQELRFTL… |
| A0A6J8DSB8 | 7-300 | ARNLKFLFILLTIKFIGADVTLYPHPSGIRSSDKFTVYVNHQQSFTYISTSDHRAQEVQHAHSHRSVSWTSFSITRGHAIVEVHTQT… |
| A0A416WC56 | 634-919 | None |
| A0A1M3DC82 | 173-465 | None |
| A0A7W5FQI2 | 1-216 | None |
| A0A356J485 | 188-454 | None |
| A0A173RXK3 | 1-272 | None |
| A0A7X6TF79 | 310-567 | None |
| A0A7W9X8W0 | 23-277 | None |
| A0A317ZK33 | 33-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.