DPCstruct | MC33617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 214 ± 44 aa |
| Standard deviation of domain lengths | 44.19 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.50 |
| Pfam Score | 99.37 |
| Assigned Pfam label(s) | CL0027- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8DRJ4 | 18-219 | LPFLFIVLPEWFRKKYPVISQSLQINERRLITPFDIYETLQNVLFFGTDQREQSSSRGISLFQEVSDERTCTEIGILPHWCTCAKNV… |
| A0A182XM58 | 169-394 | FGPVRMLLTGWLEERLPFNFIWLPEWFREEHPEIVQALKINRNRLTNPYDLHATLKHVLELSGRIDNLPGPLSCPNCQSIFAEVPWN… |
| A0A2R2MQ75 | 266-501 | None |
| A0A1D2N2H6 | 5-107 | None |
| A0A820JC00 | 37-249 | None |
| A0A7M5WT32 | 199-429 | None |
| A0A7M5WVA6 | 420-615 | None |
| A0A7E4WAN5 | 155-355 | None |
| A0A0D8XD00 | 4-143 | None |
| A0A654I618 | 7-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.