DPCstruct | MC33616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 175 ± 32 aa |
| Standard deviation of domain lengths | 31.74 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.39 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0229- CL0144 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9AIM8 | 17-167 | RLSPLFFEYPAEIKSEKGRINFKHRILRENPETLFADCSQNGTVTNLLFYTDHTTAWHTAVTSHFSYTTKKGICKGRQIHIFEDSDK… |
| A0A6J8DPU1 | 7-180 | TSARTKSKPQPYTLAKYENFNINKTRALACNRTKDINIEEKHQNYILELSAAAYEVLKGEIDIYFEHYTYKLMPKHQYDNQGLCIRT… |
| A0A7D9HI67 | 417-647 | None |
| K1RXB5 | 15-216 | None |
| A0A444U8I4 | 1-152 | None |
| A0A444U4B2 | 21-179 | None |
| A0A8B6DWF1 | 9-185 | None |
| C3Y6U7 | 9-178 | None |
| A0A6J8BB48 | 5-222 | None |
| A0A8B6DPS3 | 1-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.