DPCstruct | MC33615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 386 ± 64 aa |
| Standard deviation of domain lengths | 64.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8DL96 | 22-409 | GSHRVGDKIRHFIDQTEENDIKNVSNNKVCSHRNYEQERINSVIIWLKKAKKDMDIHTFSISAYEADKLQELRNKVNILNEKLNTLN… |
| A0A7D9JGR4 | 109-463 | FSAMARDNLFYFLDTTEKGDVECVAEDPLCKFRSYEKCRIEHVLSSLIDALSLWKISKDKVEASEIALGNEIVDSLLEATKELQDLR… |
| A0A6J8DI92 | 396-689 | None |
| A0A7D9DT63 | 33-413 | None |
| A0A6S7H4D5 | 496-1060 | None |
| A0A8B6BUL1 | 296-649 | None |
| A0A6S7GC38 | 76-464 | None |
| A0A6J8BBQ0 | 81-538 | None |
| A0A8B6FP26 | 6-358 | None |
| A0A7D9HNG3 | 10-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.