DPCstruct | MC33612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 186 ± 15 aa |
| Standard deviation of domain lengths | 14.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4JWR5 | 1-176 | MGELEEKRPHQANDSFAENTRKPFLSLVNDNSPLVCTFDYLLRLIENSIREQENQQRYLKINNSKSTRVIDHKRFKLEYWEPMSPKL… |
| M5CGK2 | 196-345 | DLPDRYSELTGGHFPLFISFDKLAQLLEADALGTNDALTLARVRLKRLVDFNLFKHQYWPKFDYNLTRRLDPALVFSEIMGVIKGYG… |
| A0A287RVF2 | 27-197 | None |
| A0A0R0IQJ0 | 171-345 | None |
| A0A0K6FPU8 | 330-547 | None |
| A0A0P0WE98 | 936-1131 | None |
| A0A5P1F0Y7 | 27-220 | None |
| A0A2T6ZN88 | 161-343 | None |
| A0A7J7GKF6 | 8-201 | None |
| A0A317SVN6 | 407-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.