DPCstruct | MC33607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511T3K7 | 99-179 | GRKATSQKSLTSWTREAWQTSTGGTRARRGATTARYLPKKAWSRLSARQKQATERRKRTASRRGRQYVANTPAARRARKTA |
| A0A2E4QBR4 | 1-77 | MALAKSQKSLKDWGKQKWRTSSGKPSKGKRRYLPDAAWKSLSASEKAATNKAKAKGNRQGKQFVKQPKKIAKKTRAY |
| A0A2D9C9K2 | 1-80 | None |
| A0A6J4UK73 | 1-94 | None |
| A0A2D8U5N4 | 1-83 | None |
| A0A6J4Q240 | 59-141 | None |
| A0A3D4UZB8 | 1-76 | None |
| A0A285R0U7 | 41-125 | None |
| A0A101MG39 | 22-104 | None |
| A0A0A2JAV0 | 82-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.