DPCstruct | MC33603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 61.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4ASD9 | 1-112 | MQPGETFADFASGLRDAAGQTRVREETLLGQFYRGLEKTTRQLVKLAPTPTTVGEAVDKATKIDDSSYNVARGMRNIGQPWATSTTQ… |
| A0A6A3JX85 | 47-127 | TMRMLMSGETYAYFAAGLRSVVGRNKVSERTLLAQFYRCLDKTTRKLVKQKSLPKVLKEAVAKATEIDDPLDNVCNGLVTV |
| A0A225WPC7 | 13-111 | None |
| A0A6A3PUM8 | 223-350 | None |
| A0A225VZN1 | 8-108 | None |
| A0A225WHK4 | 49-144 | None |
| A0A6A3KYF9 | 8-122 | None |
| A0A6A3JGF3 | 1-131 | None |
| A0A6A3MYE9 | 1-101 | None |
| W2IRJ9 | 157-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.