DPCstruct | MC33602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 195 ± 35 aa |
| Standard deviation of domain lengths | 35.08 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4A0A8 | 39-235 | LNRFLQIRESSTTRIARPAPDVTNLPMDASLATKPSKPADAKTKYAFASSHERRVVHEKLTAERHRGKDPAVYVTNEIRSEAVLCKS… |
| A0A329SSJ7 | 1-135 | MRTSFQPTSDQEHVHELFIASTLQSKSSDSFFEYVLASSTVQFDTHPGAVGRMYDLRFGRGLSIKHFRRVSFLDKLRNSGIDSTDFA… |
| A0A6A3TLZ3 | 1-149 | None |
| A0A080Z6C0 | 20-143 | None |
| A0A225WU76 | 6-199 | None |
| W2JEA6 | 12-176 | None |
| A0A081AV06 | 8-183 | None |
| A0A081B332 | 10-221 | None |
| G4ZFN3 | 2-240 | None |
| G4ZWR5 | 213-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.