DPCstruct | MC3360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 164 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845YBT1 | 141-273 | LKNTQQQKARKTQSNQEKNLPSSLPPPIPAALCLVVPAKIASSFKIGSSLSANDVVHLIDNASYFLCTLFKKANSNEELLAKTNESI… |
| A0A367RB82 | 14-157 | KFNLFKKQRLNCSSEQQEDFPVEFVALCLIVPASALKNVGENDPINISDIEKLIDNASYFLCTHIDEADYIWKLLQTTNEDIKTINE… |
| A0A7U3NLS2 | 94-250 | None |
| F1T9K2 | 58-262 | None |
| A0A846D593 | 35-205 | None |
| A0A3C1SGN4 | 199-373 | None |
| A0A0P7ZWW7 | 27-204 | None |
| A0A4V0XUD5 | 5-178 | None |
| A0A661RJ52 | 390-548 | None |
| A0A510PI92 | 7-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.