DPCstruct | MC336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06535 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5VU98 | 16-100 | EPINPCRVEECAAWFQKTKDYENLVPKATERYCQVLQTYLKCMNDTQRFCHGNLRFHSSELVMRRHWKEFECEKWESCNENQMGV |
| A0A3P8AUE7 | 18-101 | GRLAGCGLEECSQWFLRVKHYDTLTPGSNEPYCQALITYLKCLNDTTLGCRGNLQFYTNLFAMRKQFREFGCASYKQDEARNSV |
| A0A183UHN8 | 1-84 | None |
| A0A7R9E7H5 | 29-129 | None |
| A0A6V7TLU2 | 6-124 | None |
| A0A0R3R0C5 | 1-80 | None |
| A0A2G9TVN5 | 11-95 | None |
| A0A2J7R3C9 | 48-138 | None |
| A0A7R9EQL5 | 1-85 | None |
| E0VQ37 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.