DPCstruct | MC33597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 137 |
|---|---|
| Mean domain length (aa) | 138 ± 23 aa |
| Standard deviation of domain lengths | 23.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.93 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0123- PF18367 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1SA79 | 4-133 | ENLVDEWMTVPDLADALGTTASRARGVVSDRRVLGVRRGERATFQIPAKFVVSRREEQIASGKGAPVDAADDRRVVLSSLAGTITVL… |
| A0A512BV21 | 10-136 | DPLAPSLARNVEHRQTLLVSAGGAVSAEAAGQVLGITRQAVDKRRRAGTVLAVREGSDWRYPACQFDNGEVLAGIADVVRGFGSAGP… |
| A0A4S0VKH8 | 44-164 | None |
| A0A1X0UHQ8 | 18-166 | None |
| I5CWY6 | 97-233 | None |
| A0A6G3UZC1 | 14-104 | None |
| A0A7C8B926 | 48-176 | None |
| A0A1X7IUC3 | 105-263 | None |
| A0A7W0A957 | 73-209 | None |
| A0A522KIB3 | 153-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.