DPCstruct | MC33587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 270 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2YLK3 | 21-288 | IELNFREKTTNEAIATKISSNRKKYSNSMREFCGVDFCSELCYASLHLESVIKALENNLKNPTFSQDLKSSVFNSGCKLFYMLAELY… |
| A0A3Q4GGU3 | 482-747 | CEHVQKQEAVQTQITSLRRDIKKLQTDAMAPPPEILAQAAVHTENFITALVNMHKAQKSPAVQKVGVSAFYKVVSFVCEDTLRHPPT… |
| A0A6G0U2F2 | 298-567 | None |
| A0A821CNB2 | 5-284 | None |
| A0A6A4VHU7 | 1-303 | None |
| A0A5N4CBQ0 | 94-355 | None |
| A0A4Y2DMX0 | 482-723 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.