DPCstruct | MC33585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 159 ± 17 aa |
| Standard deviation of domain lengths | 16.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.34 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF03177- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182TTL0 | 1-121 | LYIADEYSKSSEKEFRYALSLLPYVEDPIEVRHRIWCAAVLRDSWEEYNKNAPLDSMQNMLFFRLIDLCYISDAGELDNFLPPLESF… |
| H2YKM4 | 2-172 | EEKVKDFNDELMILKYQGSLPSVVLDSMHTTIDAMPVYPPSKLIQLYIGDGNQQSNEVDFKKAFELLQYLDAEDGNEMEVDIEEWKM… |
| A0A833SBH5 | 244-404 | None |
| A0A2I0UAJ0 | 115-281 | None |
| A0A0E9WS79 | 1-129 | None |
| A0A7R9EHH3 | 20-184 | None |
| A0A2G8LBF0 | 332-497 | None |
| A0A2P8ZNH7 | 104-273 | None |
| A0A444TIS5 | 101-238 | None |
| A0A7R9K8C3 | 151-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.