DPCstruct | MC33583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 15.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3Y187 | 65-198 | ETTDEDEDGGSEKKYRRCEKSGCTVACPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYMAWKKIWTSNGK… |
| H2YJH2 | 1-136 | KHEEKPEISEKEKQIFLNKHSCKKSGCHKVGLTCCIQATNACMEASGKSSRWYHVSLEEHYCNGKNSGCDDFHEWKKAWMNNSKADA… |
| A0A1S3ISL1 | 224-354 | None |
| A0A3S1B194 | 182-334 | None |
| A0A4W3HST3 | 1-172 | None |
| A0A5K4F5A3 | 16-149 | None |
| A0A812DJD0 | 46-178 | None |
| A0A5J4NFP0 | 7-179 | None |
| A0A0N4Y0V5 | 31-169 | None |
| A0A3B4D2A1 | 62-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.