DPCstruct | MC33581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 401 ± 77 aa |
| Standard deviation of domain lengths | 77.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 88.21 |
| Assigned Pfam label(s) | PF15745- CL0061- PF13863 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2LS43 | 2-289 | FMLEYSIAVQNAELERLKELAESEEKKLNMAEQCLEQDAALFDEFLKDNDKSSIEAITNAEQEARRRSAMIDEIRQLSVQQQKLTAE… |
| H2YIP6 | 2-415 | FLVNFGIKTKRDEISGFKERAIMEEHKMRKRAQRLHEDAVLFDEFLKATDEAAVEAMKRTEKETKTKIEKTAELRRMQVKLNSAKGD… |
| A0A7J8FVR1 | 40-442 | None |
| A0A3Q4N7C2 | 52-325 | None |
| A0A654GLC2 | 25-489 | None |
| A0A672V281 | 5-378 | None |
| A0A672V5W7 | 73-498 | None |
| A0A0C9RMN0 | 15-407 | None |
| A0A6P8VP61 | 2-307 | None |
| A0A7J6KZW0 | 95-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.