DPCstruct | MC33580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 161 ± 29 aa |
| Standard deviation of domain lengths | 28.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815F4M0 | 178-293 | YNLYLPLCNELFDYMEELLNLVQVIFTSLDQSRTNSMTTTGQCRLNPIIVCIQDSSLLYDYIVKVLFKLHEGLSGDALQEHRQRLTD… |
| A0A0K0D4Q7 | 2-163 | ADQMDTLLNLLLNVYNAMECPRWSSLVPQGQCFHAPPILVILDSSKFYDHLVKMIIKLHGWLPPDALEGHQTRFRGIFFRTKMFYEE… |
| E7FD55 | 2-144 | None |
| A0A0N4V9S3 | 354-554 | None |
| A0A4W3IDL0 | 127-320 | None |
| A0A1E1WH17 | 165-310 | None |
| A0A3Q3WCC7 | 141-343 | None |
| A0A1B7MRP0 | 3-215 | None |
| A0A0R3UD10 | 1-153 | None |
| B4DPL0 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.