DPCstruct | MC3358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 205 ± 33 aa |
| Standard deviation of domain lengths | 33.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A515XXQ1 | 1-249 | MPQRPQPIELWAALNPRQQTYLTAVYNADQAAEGRNKGGAFDWGHGPPASEWRWQTFCLKAPKEWVGRTVIQYELDAKDEHDQGAGS… |
| A0A367R0D3 | 4-218 | HLHLWEKLNERQQATLTAIYRTDQSVEAAQKEGWRNSSIREKASVWRNLQYYFEPTSYETLLHKLLSLAGVVDQGLGSTLALLERHK… |
| A0A0D0NYJ5 | 193-434 | None |
| A0A7Y0AIC2 | 8-234 | None |
| A0A0U3FWB8 | 90-318 | None |
| A0A7W7T588 | 10-177 | None |
| A0A401Z3W6 | 213-432 | None |
| A0A0N7YMM4 | 525-741 | None |
| A0A6M1MCV4 | 4-209 | None |
| A0A239PFV3 | 11-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.