DPCstruct | MC33579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 14 aa |
| Standard deviation of domain lengths | 13.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4S6J0 | 521-662 | RELISLAMPSADRNTDSSTVPQVHALNILRALYRDTRLGENIIPFVSDGMQAAVLGFTSPVWAVRNSSTLLFSTLITRIFGVKKGKD… |
| Q4RN44 | 211-333 | RGLIALAVPADGDSDGSNVPQVHALNILRALYRDTRLGENIIPFVSDGMQAAVLGFTSPVWAVRNSSTLLFSTLITRIFGVKKGKDE… |
| F6YB51 | 36-184 | None |
| Q553Q9 | 1298-1466 | None |
| A0A3P7NYH8 | 407-540 | None |
| A0A0R3TG28 | 116-246 | None |
| H3DEK2 | 24-175 | None |
| A0A811WUQ5 | 285-439 | None |
| A0A7R9P8U6 | 225-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.