DPCstruct | MC33576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 190 ± 33 aa |
| Standard deviation of domain lengths | 32.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2YCQ8 | 7-212 | PPLSYKKWILRGSGSIAGHVSPGSVVLSPFDQMRTASVLGGFNASVSSNSPTMAQYVTVGTSPFVGFSYALDGSSQPLLSHVALAVA… |
| F2DT59 | 170-357 | LQIMLQKSFQEVKSRMWKDKFEQEDDEDTSSFEKTPLQIWNVSKFGSCVDAAIVGLMPPPLLELQSSQRHYCAITVGEDAVVSAYRL… |
| A0A453KLB5 | 30-189 | None |
| A0A4Y2FZ59 | 4-154 | None |
| A0A1I8GXY8 | 1-195 | None |
| U9SV61 | 169-382 | None |
| A0A1A9WZT5 | 1-150 | None |
| A0A367JJM3 | 5-188 | None |
| A0A177WN01 | 15-253 | None |
| A0A1R1XAM9 | 74-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.