DPCstruct | MC33574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 174 ± 16 aa |
| Standard deviation of domain lengths | 16.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9D3S8 | 346-522 | LQEQELDLAELDSQDSAYLQESRLKRRLMHVFKRLCQLKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINQPEAFPDFADILKVV… |
| H2YCA3 | 3-179 | QAHELTLDEMTEENSVYVEESKLKDRFMKIFNKVCALKKVNSATGRAIERKITVASCRFPEINRKVEQYVNKSKKFPDYYSVHYLVK… |
| A0A817CLN5 | 293-448 | None |
| U5EF61 | 285-456 | None |
| S4RHT7 | 21-175 | None |
| A0A553PEH0 | 678-857 | None |
| A0A814W1S0 | 237-368 | None |
| A0A0C2IGW1 | 40-215 | None |
| A0A7M5VEL7 | 569-747 | None |
| A0A818R9C3 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.