DPCstruct | MC33573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 797 ± 118 aa |
| Standard deviation of domain lengths | 118.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0276- PF16214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8JNU1 | 662-1500 | KEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTSLSDQCT… |
| H2YBD3 | 67-990 | VSFLIDRSRRGTFLETRECIRTRIKLEKENHNQERLILSVIPRFIALQMINDISNTIGSFELLPKFGGNLRNPIYVHKYDNVSILYA… |
| A0A504Z8S0 | 26-838 | None |
| A0BMP1 | 85-807 | None |
| A0A5B8MNS6 | 367-1279 | None |
| A0A6J3C6A6 | 2-776 | None |
| A0A653BZW0 | 57-1051 | None |
| A0A3Q2PK69 | 98-809 | None |
| A0A7S1Q0Y4 | 350-1021 | None |
| A0A1Y3EXR6 | 1-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.