DPCstruct | MC33572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822HXW8 | 64-201 | EGSVLGRQRDCEMSKTISPSTYVRNLSPALFRQLSDFLDPQEGWKKLAVDIRKSSGEPRYTQLHIRRFEGVIQKGKSPTHELLYDWG… |
| H2YAX6 | 1-157 | MAWGWGSINTQRKKATMQTYIRNLPYSVLKSIADDLDVAGTATNWRDFVLKIPRSQNDPEPRYDLQDIRRFEMIAGRGESPTTAALD… |
| A0A3M0JE11 | 8-136 | None |
| A0A672JT35 | 1-145 | None |
| A0A4U1EGQ4 | 1-145 | None |
| A0A4W3I5T5 | 1-139 | None |
| U3IXR5 | 73-212 | None |
| A0A6P8SAF8 | 1-154 | None |
| T1WSI8 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.