DPCstruct | MC33571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 322 ± 76 aa |
| Standard deviation of domain lengths | 75.60 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 69.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | PF10155- PF03849- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Y8B0 | 10-298 | SNLLGFLQEEEIANQQFESFSPALQRAGFNKQDHFRVASSVVLLLQHKDLLTGQHQRLAAMYLLYDMYKNEPVAANPFAPVFTHLLQ… |
| A0A4Y7QJB8 | 23-394 | RASVIHLMSKACSLPCTAAALAFNQLVQPTARFQLALDALLPLLSGNGELPQRILVSYILYSLYATHPIAMNPFKIAFAEVFIRERD… |
| A0A5J5CDD0 | 38-378 | None |
| A0A164X4F3 | 6-241 | None |
| A0A182FHF5 | 501-877 | None |
| A0A5B7DIH9 | 78-325 | None |
| A0A068V770 | 18-348 | None |
| A0A7I4CLW1 | 4-252 | None |
| A0A7S2T9G5 | 6-372 | None |
| A0A182IY47 | 1-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.