DPCstruct | MC33564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 365 ± 35 aa |
| Standard deviation of domain lengths | 34.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9XZH6 | 1-361 | MKEWMLREASNLNALQEGGTFRRTLWKRIQSMVTPLLAYMVSILDRDYNLNLLVKPTTEDCVKDLWLFIFNELKLLDIPYVMGQSSA… |
| A0A060XR48 | 132-491 | EWVNREAKKRQALQEGGTLRHTLWRCLQSTLTPVLAYMVEVLDRDANLDLLISAGLSKALIQLWLDILADRHILDLTPPQNSSGSDQ… |
| A0A7J5YYY1 | 2-322 | None |
| A0A7J5YZS4 | 2-322 | None |
| A0A4Z2CGM4 | 45-399 | None |
| H2YLI2 | 3-390 | None |
| A0A7J7KTR9 | 692-1070 | None |
| A0A4W5LM34 | 61-415 | None |
| A0A7D9IV44 | 26-389 | None |
| A0A024R8W2 | 480-832 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.