DPCstruct | MC33560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 235 ± 52 aa |
| Standard deviation of domain lengths | 51.83 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9X8N1 | 18-213 | GHQNCTEMEDNKPRLRFRLQFNDTEGVRPQNETYSVDCDAPQADEARSNSGFASATTNCTKTNMAVTFPRLIPSFRDELTGVRPGMG… |
| A0A4Z2FU79 | 30-247 | YSLTSTAQRSVLRSRYKRPQAEMTMVDGVLVEVVRVSLFTKQKLMVVIIDVTMACTVNSGSFDGARLVWDIPLVMTSLVGEGVGFES… |
| A0A6P8GS17 | 71-310 | None |
| A0A7J5YP09 | 360-628 | None |
| A0A5J5C8J8 | 1-246 | None |
| A0A6P6PQL2 | 38-335 | None |
| A0A4Z2HSX4 | 173-344 | None |
| A0A498MAM4 | 49-359 | None |
| A0A3B5KUN0 | 1-253 | None |
| A0A0F8CJF2 | 35-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.