DPCstruct | MC3356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D3NSH7 | 2-128 | TINHITLMTGDNVLHRLDIIPPEVVEQCRELLPEGGQIPGFPAFRVEIHAPVFTIWRGREPIATCGLGQGEDDVWSTLRDLQARFAP… |
| A0A845D3Q2 | 1-138 | MDRRELRHIIVESGREMISGRGQVDDWAIEQLTPVVKQAVKSGRRNQVLSGYWIHCELRDGRLAVAIGHAGAGERVLVSMTVQPAHP… |
| A0A6L8FPT7 | 3-145 | None |
| A0A174NZV8 | 3-150 | None |
| A0A2N8HHD6 | 30-177 | None |
| A0A0J6SVP4 | 34-155 | None |
| A0A7Y7DMY8 | 1-130 | None |
| Q7VPC7 | 138-278 | None |
| A0A660MM98 | 205-342 | None |
| A0A848EP61 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.