DPCstruct | MC33559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 148 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815KKU8 | 21-152 | LCCLPNGIESDLLEIYDCLCSTLNFIRFIGLIDKRNINQTLIWTEHLNHLNETFIKPLRKSIELARAHYKLEIKNKKEDNKPQQMDT… |
| A0A6I9X473 | 1-138 | MVLSLPEGAETDLLQHSDRIMASLNLLRYLFIKDKEDDNKTCVWTELYKIESNFLKPLHTGLNMSRAHYEAEIKRKKENKKEPHSSK… |
| A0A2A3EMB8 | 426-580 | None |
| A0A212F5T2 | 174-320 | None |
| A0A6F9DDV5 | 140-287 | None |
| V4A5T5 | 352-504 | None |
| A0A5E4PXZ8 | 355-492 | None |
| A0A482W1R3 | 16-157 | None |
| A0A1A8AW10 | 185-338 | None |
| A0A4Y0BPP4 | 245-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.