DPCstruct | MC33558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A442IF55 | 5-74 | LFAVVSNTTGETILVKERESGYWPAPLIEDPRAFNTRKGHTVQEVAAAYVGSMFGWRIPGAMPETYTVDE |
| A0A0U3FKI5 | 4-86 | LPEQCYNTLLSTGELVTIKKNEKGYFPSELSTPDMLTNRAIAERANRKAGITKAQTAAMVGGSLFGWSSPAANPDNYDANGNF |
| A0A845RK54 | 330-416 | None |
| A0A5H2YFT0 | 2-91 | None |
| A0A559IEG1 | 9-90 | None |
| A0A1Q6L0Y0 | 4-80 | None |
| A0A7T1DZ00 | 16-89 | None |
| A0A1C2XTL2 | 5-74 | None |
| A0A3D5LQ65 | 79-163 | None |
| A0A173YN83 | 8-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.