DPCstruct | MC33555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 20 aa |
| Standard deviation of domain lengths | 20.00 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U8RSP3 | 109-272 | VKVLGDRTMRTCTDAKACTSGDNEQQQGTVAGTGFAPVLEEATRVNTEQLVRLVNGQEKPTAENLAKLKTGSLAVSAGVINALRRDP… |
| S5NN86 | 29-176 | IGLHPLIDEEKAKILPLLTDLVNGSQKPGFDNLAKASGGSMQLTRGVVEALRDDPDAAVLTERLAGELALARVTEQALLARRTLLAG… |
| A0A2X1PVG9 | 140-280 | None |
| A0A6N9BQ44 | 14-175 | None |
| A0A379F614 | 271-460 | None |
| A0A3M3VPM3 | 224-415 | None |
| A0A839TA60 | 168-359 | None |
| A0A484S5S2 | 350-543 | None |
| A0A2G6KUM1 | 7-155 | None |
| A0A485GLI3 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.