DPCstruct | MC33553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 15.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9HC10 | 1-121 | MTNEGKVGTYKQLVKQGTAFDNITPHHMPSAEKMKQAGIKRNDGVSMNMEQPHPGTGGRHRETYTYGLSGEKSKAYLNLSFRDALAH… |
| A0A2W7A019 | 2-108 | KGGAYKAVRETNQGGEVHHMPAASASHLSVEEGSAIWMETLDHRQTSSWGRSRSAIVYRKQQQAFIQQGKFLEALQMDIDDIRSKFD… |
| Q1ZSW9 | 1-105 | None |
| N9SE54 | 81-202 | None |
| A0A811G1T5 | 53-165 | None |
| A0A2C1ZS92 | 33-186 | None |
| A0A318ELK0 | 46-179 | None |
| A0A2K4VMT9 | 729-876 | None |
| A0A7V7HYY7 | 20-133 | None |
| A0A0Q2Y0N4 | 579-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.