DPCstruct | MC33551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 126 |
|---|---|
| Mean domain length (aa) | 127 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.75 |
| Pfam Score | 97.14 |
| Assigned Pfam label(s) | CL0123- PF01594- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510J8D5 | 2-116 | KLTKNRQKVLDLIQISDIPVNVKFLKTKVDFDLSTIYRALDFLEKNKLVFSFDFENEKYYFKEENANFFICDTCKHIETVPDFSDSE… |
| A0A233IJV9 | 5-134 | CAARGVRLTSQRKRVFELICSSKKASSAYELLEDLKQSEPQAKPPTVYRALDFLLEQGFIHRVESTNSFISCCSCNANKHFSHLLIC… |
| A0A0K0SW03 | 8-150 | None |
| A0A1W9RM59 | 8-139 | None |
| A0A4P8RAB9 | 12-125 | None |
| A0A6N8VYX2 | 39-177 | None |
| A0A1Y4HHD7 | 7-126 | None |
| A0A2A2RJQ6 | 18-163 | None |
| A0A7J0BRM9 | 14-132 | None |
| A0A258QYM2 | 6-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.