DPCstruct | MC3355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 259 ± 30 aa |
| Standard deviation of domain lengths | 30.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.81 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF18588- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6DD93 | 148-452 | PRHEKKKFAIYGNCQSLALASVLMRFSDFRNKFEIIKLDPVHLISNAAHDAFLNKSLPNLDVLLYQPVKEGYRGNDRFSSKYLLTQL… |
| A0A0Q9T6I4 | 10-238 | RRIVEGADVAIVQPVRDGYRGLAVGTEEILAHNAKEPTVLRYPAIYYTGLHPYLVYVHATGELGTPMPVTGGYHDLRFISVASSGAM… |
| A0A7K0PE50 | 27-292 | None |
| B0UMM8 | 8-207 | None |
| A0A3A9D5Q2 | 367-625 | None |
| A0A2D7KEY4 | 14-283 | None |
| A0A0D6P9W5 | 14-293 | None |
| A0A6C0JDL5 | 304-564 | None |
| A0A6C0HFE3 | 23-276 | None |
| A0A6S7B875 | 12-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.