DPCstruct | MC33548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 127 ± 30 aa |
| Standard deviation of domain lengths | 30.03 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 79.44 |
| Assigned Pfam label(s) | PF04561- CL0410- PF04563- PF04565- PF04566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A199YUI2 | 5-121 | GTFINNGSERLIVSQLVRSPGSYFHLKADKNGLESFGHTTIPNRGAWFELDTDAKGIGYVRIDRTRKLTFTTMLRALGFGSDEEILE… |
| W1DQD2 | 110-211 | MGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIIL… |
| A0A4W5PG09 | 79-259 | None |
| A0A1V5JVL6 | 70-160 | None |
| Q8HTL6 | 219-359 | None |
| A0A396I4D4 | 5-100 | None |
| A0A345HH11 | 109-250 | None |
| A0A820V5C5 | 32-207 | None |
| G6C2T1 | 126-218 | None |
| A0A7R9KBR6 | 5-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.