DPCstruct | MC33546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7BKV0 | 2-107 | ESEMAMLRQYGPDVSDATLKRLVSAFSDLREMADQGLINYPYSTREVVNMVRHLQFYPNEGLPTVVKNVFDFDSYNKELQETIVETM… |
| A0A0K0DR63 | 89-183 | ENELEMLKKYAPDVPDANLLKLMAAFTELREMADEGLLQYPYSTRELVNIVKHINKFPTDSLSTVIKNIFDFDTFSTEAFNTVREVF… |
| M4B1C1 | 70-174 | None |
| A0A7J8E0H3 | 66-171 | None |
| A0A3R6WRT9 | 200-295 | None |
| A0A1B6BXM8 | 724-831 | None |
| A0A4Z2IMF3 | 250-355 | None |
| A0A6P8XG97 | 801-894 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.