DPCstruct | MC33544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6K9H9 | 1-111 | MKRYSRHIQQELRKLALLAVEKELRLQLTELSTQFHAWKSGEISSRELRHVIHLYVDGPSRELFRQHREVPADIFVADAFARGVLQK… |
| A0A841H3T4 | 1-101 | MEIQERDWKVLRDLKQIALDRFCAQVLDECTRIIQNERLGAHDRYRRVYEITRERDRKLADTFDGLRRSNAFFALMAIRHQGLLTQD… |
| A0A7Y4UE62 | 8-109 | None |
| A0A0S7X854 | 10-117 | None |
| A0A1J4VIJ1 | 6-115 | None |
| A0A2Z2NUM1 | 2-91 | None |
| A0A1H4GH55 | 1-102 | None |
| A0A3Q9D6L3 | 1-101 | None |
| B9XKG3 | 1-105 | None |
| A0A081BMZ5 | 21-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.