DPCstruct | MC33540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811XBW2 | 11-74 | GQEDNWRTQTFRQNVVTKIEEAIQRSGMQVARNSSEMENHVFKKAKTREEYMNMVAKLILHVRD |
| B2RZ40 | 1-79 | MDVSGQETDWRSAAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVS |
| A0A4W4FZ91 | 4-95 | None |
| A0A182TZC5 | 4-79 | None |
| B4DN68 | 2-73 | None |
| A0A182KGN1 | 7-87 | None |
| A0A6P3YH25 | 4-82 | None |
| A0A671DM65 | 1-86 | None |
| A0A670ZWN5 | 2-80 | None |
| A0A803XYN3 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.