DPCstruct | MC3354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 292 ± 34 aa |
| Standard deviation of domain lengths | 33.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A7VGS6 | 237-500 | IELIWSYWHEEGAQCQAMNAIALRFQNRKSRPGRDPLANLAIDPLRPAQNLLWGWVEASYKRLTVERRAYEYDHHYGLTLLGKAVPQ… |
| A0A0Q9T636 | 113-451 | ASAADGSDVASSGPAFGSKPYLALRDAARERVGEMTVSDFRDLLPSRFVAGLPANDTFFRFPKLAGPPSDQRPWPLPAVELIWSYWL… |
| A0A1M3MVG2 | 60-306 | None |
| A0A1Y2JAJ0 | 132-435 | None |
| A0A538N4T4 | 133-387 | None |
| A0A7H5EWL0 | 6-372 | None |
| A0A538QBH0 | 1-278 | None |
| A0A7M3LZN3 | 3-306 | None |
| A0A7Y4Y2B0 | 288-539 | None |
| A0A654LX57 | 2-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.