DPCstruct | MC33538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 251 ± 45 aa |
| Standard deviation of domain lengths | 45.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0705 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094ZYZ1 | 49-254 | YLQDAVVLLQNDPNSSEARRKLIEGSRGILQGTSSVLLTFDMSEVRKIIRHCRRVLSVLATAEHVSSLTGLADFVKRLTPCMADMIK… |
| A0A0G2JY03 | 24-242 | MVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAA… |
| A0A091E2Y1 | 121-342 | None |
| A0A553MQ03 | 70-274 | None |
| A0A6I8PMU4 | 760-994 | None |
| A0A7M3RJZ6 | 3-312 | None |
| A0A1S3Q645 | 93-353 | None |
| A0A5K4F9Y9 | 3-152 | None |
| A0A2A2KRH9 | 137-429 | None |
| A0A6J0UWJ4 | 51-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.