DPCstruct | MC33537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139HRS9 | 8-126 | EFHAPTWHYQNQTPVIDGKYIDRDTGETKTISVNQSEFLGPPAVDVVIRSQHEDTTQCVFRASRAVPMEALLGHIMGIVGEKKLQLD… |
| A0A7S8DKV1 | 9-101 | YTVDPSTNPSTWPGSDPTTSTIIWKVDVIYINMHGDSNFRTLRTGTNEHVNQAVIQVTKHIARGLYDIVSMNVSDYSCVVVISTEKS… |
| A0A1V8SXM3 | 3-122 | None |
| U7PJP1 | 158-281 | None |
| A0A0F7ZK71 | 23-140 | None |
| A0A162NXZ5 | 3-109 | None |
| A0A5N5Q2M6 | 54-160 | None |
| A0A6A5SBM3 | 1-112 | None |
| A0A7U2MLD7 | 7-127 | None |
| A0A2J6RDZ4 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.