DPCstruct | MC33536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 217 ± 36 aa |
| Standard deviation of domain lengths | 35.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M6JFB0 | 18-198 | RRLWNRAPTVGHVAELMAWFCLGELQSWPGHDGPTDPETREANLGPVLAHACRSGFITTGSQPGIDRDPEDGFEQRAAVDGLATAEV… |
| A0A139HPS7 | 20-257 | ADGDDWQRLWNDAESWQGFLDANRAFLRGEMSQSPYYHAQISEETKPLVESLLKLHDYGFLTYCSQPSRDDKDAYFIERDCCAKCGN… |
| A0A4D4KS78 | 13-193 | None |
| B5VIK4 | 184-408 | None |
| A0A146H906 | 368-594 | None |
| A0A0C2YK55 | 245-464 | None |
| A0A5B1QRE1 | 232-452 | None |
| A0A6A5UCN9 | 2-252 | None |
| A0A7D9LEC5 | 112-287 | None |
| A0A4U0VEC5 | 364-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.