DPCstruct | MC33528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837IM66 | 319-417 | VEIADTPDLQIQGLSGRQSLDEDKGMLFVYEKPAVLGFWMKDMRFPIDIIWLGDDMRVLGIEARVSPDTYPTVFYSPEPVRYVLEVN… |
| A0A6H9I3I4 | 60-185 | QFTNEGSLRFLNSADKSLGSIEIEIADNPSERSQGLMFRKSMQENQGMLFLFPLEEPQSFWMKNTHIPLDIIFVNAKKQIVKIHKNT… |
| A0A7X2PEI9 | 6-119 | None |
| A0A2E4CAC1 | 13-114 | None |
| K1ZCV5 | 2-97 | None |
| A0A7C4BHA6 | 39-137 | None |
| A0A7W6FQ37 | 55-181 | None |
| A0A0H4CE77 | 12-125 | None |
| A0A2T2RU99 | 108-235 | None |
| A0A7K2AKP0 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.