DPCstruct | MC33525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 172 ± 18 aa |
| Standard deviation of domain lengths | 17.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9HE52 | 145-303 | QHADKFPTWEALFTLTTDQLRELGVEPPRARRYLLRWRQRFREGKFGIGGDLKHVENGVAYLKIHEKEASPTRTSRRVVNVPANQHV… |
| A0A319ETG4 | 1-188 | MSKHASKLPSWDTLFTLSSTELRELGIEPARQRRYLLRKREKFRKGVYGPGGDLENVVDGVAQLRVVEVPLELKDTTSNKETSRSVN… |
| A0A4S9GNT4 | 57-228 | None |
| A0A1B8FXQ1 | 58-199 | None |
| A0A6S6W424 | 55-239 | None |
| A0A0G2F437 | 1-168 | None |
| A0A5M9MGU2 | 1-154 | None |
| A0A2B7YD16 | 95-299 | None |
| A0A0M9W9V8 | 62-243 | None |
| A0A0M8MVK1 | 33-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.