DPCstruct | MC33523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 326 ± 53 aa |
| Standard deviation of domain lengths | 52.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A319EBC7 | 9-399 | AIISIMQVCMQAELDGKQALEPEMFNVDPVVRMHVKELLDLVYSTKSVLDPLISETSQITIDPALSTLIDNWEESPEKFEAHVSSRQ… |
| A0A2I0S317 | 14-286 | DPARESFWMNGEEDEVALDLRHHLRIIFKALEKRPQLRSKLGYGVVKSGDQDARRFRGIVKYSGPDKDTVDLLEAHSGDWKTNPLSF… |
| T5BL07 | 17-384 | None |
| A0A2T2N6N1 | 14-404 | None |
| A0A2T4H6V1 | 39-309 | None |
| A0A5N6EAR6 | 11-362 | None |
| A0A093Y3L1 | 237-524 | None |
| A0A2V1BA18 | 17-441 | None |
| A0A1V6S6T7 | 51-388 | None |
| A0A428S269 | 1-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.