DPCstruct | MC33521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 212 ± 35 aa |
| Standard deviation of domain lengths | 35.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 11.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A319DUI4 | 11-233 | YVNFQDNRVPSKLDSRVKELKSMLNYTHQWLDIWAGKNTDDQIKAGNLSSGSDIESQTARNNYRHKVIDVLVGKAAWMMESSTQDKS… |
| M5C5V3 | 5-191 | AVFDEYGSLPGHLVNPAKQVMKFTGYFLDVQTQRFNWSAYKDSIDNRPDTDMVIEQYEDNSIAQQDVSLEVMVDKVGDVLRRVGGVE… |
| S9QC50 | 918-1117 | None |
| A0A7D4HUA4 | 263-472 | None |
| A0A249Q6B1 | 2-203 | None |
| A0A319CZ13 | 25-203 | None |
| A0A1E5A1U1 | 50-295 | None |
| A0A1C4SZG0 | 54-242 | None |
| A0A813VTF9 | 294-473 | None |
| A0A165ZAG5 | 19-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.