DPCstruct | MC33520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 200 ± 30 aa |
| Standard deviation of domain lengths | 30.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SSI9 | 1-219 | MAPSSLSLVLLAAAYATANDVQYITDLNLYSLLAPCAQSALSQNVQNQISSCGEGVTELQSCVCTKGNNYADISTAISSSLSYSCDS… |
| A0A319DTS3 | 136-350 | TSVASSTPSSSPTTASSTTSVTTASPTPTTSPAATTAAATTSTTTTGTASLTAISQLPTCGQTCFNNMLAEYETLGCTTSDPSCLCR… |
| A0A6V8R8C2 | 64-216 | None |
| J5J532 | 316-502 | None |
| A0A6A5W0C0 | 303-506 | None |
| A0A175W8C5 | 222-440 | None |
| A0A0C3CBD4 | 10-241 | None |
| A0A094EF01 | 27-209 | None |
| A0A135TBI5 | 226-430 | None |
| A0A168GPL5 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.