DPCstruct | MC3352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5PW82 | 1-71 | MLTPKNIGEIAYWMPTTCAYRLRYEGKPLYDWHPLISGDPETVHSAGISVKGWTVPEFEVDEDEWEDYIIE |
| A0A7X4C0C5 | 129-202 | IQLSPGNIAEIPWMPSSCAYRLLHEGRELYWWHPLVSGDPETVHLAQMSVRGKVVSEDEAGTGQEDLERHIVDW |
| A0A090MSA3 | 2-82 | None |
| A0A6I4SRM7 | 258-343 | None |
| A0A521QLJ6 | 89-153 | None |
| A0A2A2K322 | 227-294 | None |
| A0A447UGJ7 | 28-95 | None |
| A0A7Y2EPX0 | 13-86 | None |
| A0A2X3C468 | 7-74 | None |
| A0A4P0YA10 | 40-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.