DPCstruct | MC33517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 140 ± 23 aa |
| Standard deviation of domain lengths | 22.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 98.12 |
| Assigned Pfam label(s) | CL0111- PF01722- CL0487- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0PGI7 | 41-175 | RFLILPVITLFMIIVRALIALGTFSGSGGDKKYGDFEAQRHWMEITLHLPIKEWYFHNAEWWGLDYPPLSAYLSYIYGKIGHFIEPA… |
| H3G5Y9 | 2-147 | VLIRWLVGLHSYSGEHTPPMFGDYEAQRHWMEITINLPVSDWYFNTTSNDLLYWGLDYPPLTAYVSYFFGRTAEVAEPAMVELTSSR… |
| A0A1R0H9K7 | 73-204 | None |
| A0A1V2LJX8 | 3-108 | None |
| A0A5B7F3B2 | 33-124 | None |
| A0A835HHN9 | 2-130 | None |
| A0A7S1XQQ6 | 62-238 | None |
| A0A834XQC2 | 8-148 | None |
| A0A7R9KL89 | 9-142 | None |
| A0A820HFV3 | 4-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.