DPCstruct | MC33516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0PE15 | 1-100 | MNFFHGINPTTALPYSPPVSFRTVPLGSVVTNGSSKKKKTAGFTSIPDRKEILEGKCHKCKKWVRVQGVKEQEVKVAEIFWWKHARS… |
| A0A2N5UBH8 | 633-707 | YHLSFFHGINNADGLPFSPPVEIRLVKRCHVAANEKLELKEGRCHQCNKWVPMEGVKMQEVKVPELFWWKHAKSC |
| A0A0B7F806 | 899-975 | None |
| X8J4A0 | 381-457 | None |
| A0A1Y1XPQ3 | 138-206 | None |
| A0A0C9UP36 | 3-99 | None |
| A0A077WFT6 | 173-263 | None |
| F8P1Q1 | 14-93 | None |
| A0A1Y2HEK4 | 57-128 | None |
| A0A4V2MVF6 | 446-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.