DPCstruct | MC33513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 42.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0PBD6 | 1-96 | MSYEDAEAIYITLNDNVRTTDELSQLLCYLPQLHGGLAPIAFGLFHPNPKVQFAIAELLERLDSHIAGRHFISDLNRFQKFAFSRIL… |
| A0A0G4M5W6 | 150-268 | HDRLRTQRLNPAQSREIYIAFSKYIFSYDEICLFLSVAPESHAGLFYLALGLFHKDREVRTRTADLLERIGEHEAGQHWWKGLSRFE… |
| E2LDE5 | 1-99 | None |
| A0A0G4M657 | 316-434 | None |
| M7V0T1 | 721-840 | None |
| A0A1U7LH49 | 419-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.