DPCstruct | MC33509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 218 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8RBQ3 | 1-229 | MTQTAGEYKITLETVTYKPVAGKTKDHENLVNALINSFRYETDLIYITDRREAVNINNNPVRSIGGKLEKEPGAVSVMNNQSVNGIN… |
| A0A7X7CL34 | 300-521 | TGTYQFTVETVTYKSTNNDTEDHKNIVQALINSFRYESNLVYINNKNQAVDLRNQPANKKGTVYAPKTAAITAANPVGLNGVRWLQV… |
| A0A1V5M8D0 | 1-200 | None |
| A0A7X6UNL0 | 256-476 | None |
| A0A7X8LWZ6 | 130-354 | None |
| A0A2S8R6K1 | 746-970 | None |
| A0A7X9D2H3 | 699-911 | None |
| A0A3N9P077 | 176-393 | None |
| A0A7X3CMV5 | 592-818 | None |
| A0A7X8JXI2 | 573-772 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.